Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q46M01

Expression Region

1-160

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA FLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENINKF ANPFRRPVAMSLFLFGTVLTMYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RhoGDI (ARHGDIA) (NM_004309) Human Over-expression Lysate
LY401371 100 µg

RhoGDI (ARHGDIA) (NM_004309) Human Over-expression Lysate

Sign In for Pricing
View Details
DAP3 (NM_033657) Human Over-expression Lysate
LC403256 20 µg

DAP3 (NM_033657) Human Over-expression Lysate

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS3), CF594 conjugate, 0.1mg/mL
BNC941743-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EPS8L2 (NM_022772) Human Recombinant Protein
TP310265L 1 mg

EPS8L2 (NM_022772) Human Recombinant Protein

Sign In for Pricing
View Details
ETV3 (NM_001145312) Human Over-expression Lysate
LY428815 100 µg

ETV3 (NM_001145312) Human Over-expression Lysate

Sign In for Pricing
View Details
FABP9 (NM_001080526) Human Over-expression Lysate
LC421081 20 µg

FABP9 (NM_001080526) Human Over-expression Lysate

Sign In for Pricing
View Details