Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q46M01

Expression Region

1-160

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA FLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENINKF ANPFRRPVAMSLFLFGTVLTMYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® HL TRT-OH
HL12012.5G 5 g

TentaGel® HL TRT-OH

Sign In for Pricing
View Details
Retinal protein 4 (UNC119) (NM_054035) Human Recombinant Protein
TP312513M 100 µg

Retinal protein 4 (UNC119) (NM_054035) Human Recombinant Protein

Sign In for Pricing
View Details
Biotin-cGMP, 1 mg
#00021 1x 1 mg

Biotin-cGMP, 1 mg

Sign In for Pricing
View Details
(R)-(-)-2-Amino-1-butanol
TRC-A602205-500MG 500 mg

(R)-(-)-2-Amino-1-butanol

Sign In for Pricing
View Details
Human SFTA2 activation kit by CRISPRa
GA118049 1 Kit

Human SFTA2 activation kit by CRISPRa

Sign In for Pricing
View Details
UBE2C (N-term) Rabbit Polyclonal Antibody
AP17818PU-N 400 µL

UBE2C (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details