Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q46M01

Expression Region

1-160

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA FLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENINKF ANPFRRPVAMSLFLFGTVLTMYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon
CB607582 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
ASB15 Antibody
KC-7854-01 50 μL

ASB15 Antibody

Sign In for Pricing
View Details
ASB15 Antibody
KC-7854-02 100 µL

ASB15 Antibody

Sign In for Pricing
View Details
ASB15 Antibody
KC-7854-03 1 mL

ASB15 Antibody

Sign In for Pricing
View Details
CDC6 Rabbit Monoclonal Antibody
TA422806 100 µL

CDC6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human FIZ1 activation kit by CRISPRa
GA113769 1 Kit

Human FIZ1 activation kit by CRISPRa

Sign In for Pricing
View Details