Recombinant Chicken Protein cornichon homolog 2 (CNIH2)
This Recombinant Chicken Protein cornichon homolog 2 (CNIH2) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Protein cornichon homolog 2, Cornichon-like protein
UniProt
Q401C0
Expression Region
1-160
Origin
Gallus gallus (Chicken)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI CCLLRKLVVPEYCIHGLFCLMFLCAAEWVTLGLNLPLLLYHLWRYFHRPSDGSEGLFDAV SIMDADILGYCQKEAWCKLAFYLLSFFYYLYSMVYTLVSF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040813-100 1x 100 µL
CD74 (CLIP/813), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742782-100 1x 100 µL
Calbindin 1 (CALB1) (CALB1/2782), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042207-100 1x 100 µL
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 