Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q4G3F7

Expression Region

1-160

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSILKKPDLADPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVCILGTIACCIGLGVLEPT PLGEKADPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPIGLITVPFIENVNKF QNPFRRPVASLVFLFGTFTAFWLGIGATMPITQALTLGFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARID3A Protein Vector (Human) (pPM-C-HA)
12354021 500 ng

ARID3A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human GUK1 Protein
E30P5094 20 µg

Recombinant Human GUK1 Protein

Sign In for Pricing
View Details
pLV3×FLAG-CopGFP-Puro Plasmid
PVT63030 2 µg

pLV3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral human UBE2G2 sgRNA gene knockout kit - Lentiviral human UBE2G2 sgRNA gene knockout kit (25)
GTR15376014 1 Vial

Lentiviral human UBE2G2 sgRNA gene knockout kit - Lentiviral human UBE2G2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
ZG16 Protein Vector (Rat) (pPM-C-HA)
PV318232 500 ng

ZG16 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Vtcn1 3'UTR Luciferase Stable Cell Line
TU122163 1.0 mL

Vtcn1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details