Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q4G3F7

Expression Region

1-160

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSILKKPDLADPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVCILGTIACCIGLGVLEPT PLGEKADPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPIGLITVPFIENVNKF QNPFRRPVASLVFLFGTFTAFWLGIGATMPITQALTLGFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SodB Polyclonal Antibody, HRP Conjugated
A66983-050 50 µL

SodB Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit CRP (C Reactive Protein) ELISA Kit
ERb22500 96 Tests

Rabbit CRP (C Reactive Protein) ELISA Kit

Sign In for Pricing
View Details
GFP hsa-miR-376b-5p AAV miRNA Vector
Amh1181000 500 ng

GFP hsa-miR-376b-5p AAV miRNA Vector

Sign In for Pricing
View Details
Rarg (NM_001135249) Rat Untagged Clone
RN200012 10 µg

Rarg (NM_001135249) Rat Untagged Clone

Sign In for Pricing
View Details
Acy1 Mouse shRNA Plasmid (Locus ID 109652)
TG505900 1 Kit

Acy1 Mouse shRNA Plasmid (Locus ID 109652)

Sign In for Pricing
View Details
FUBP3 Rabbit Polyclonal Antibody
TA376376 100 µL

FUBP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details