Recombinant Cucumis sativus Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Cucumis sativus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q4VZK4
Expression Region
1-160
Origin
Cucumis sativus (Cucumber)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681788-100 1x 100 µL
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742038-100 1x 100 µL
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941786-500 1x 500 µL
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details