Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q7U4U7

Expression Region

1-160

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHILKKPDLSDPKMRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACIVGLAVLDPA MLADKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLVPLGLMLVPFIESFNKF QNPFRRPVAMTVFLFGTVTTIYLGIGAALPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HOX11 (TLX1) activation kit by CRISPRa
GA102181 1 Kit

Human HOX11 (TLX1) activation kit by CRISPRa

Sign In for Pricing
View Details
Human SF3B5 activation kit by CRISPRa
GA113167 1 Kit

Human SF3B5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS715763 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS805793 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF647 conjugate, 0.1mg/mL
BNC472265-100 1x 100 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5mL MacroTubes®
C2530 500 Units/Case

5mL MacroTubes®

Sign In for Pricing
View Details