Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q7TUF3
Expression Region
1-160
Origin
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENVNKF SNPFRRPVAMSVFLFGTFLTIYLGIGACLPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4735404 1.0 µg DNA
Mpped2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
MBS6154493-01 0.1 mL
RABEPK (Rab9 Effector Protein with Kelch Motifs, 40kD Rab9 Effector Protein, p40, RAB9P40) (HRP)
Sign In for Pricing
View Details MBS6154493-02 5x 0.1 mL
RABEPK (Rab9 Effector Protein with Kelch Motifs, 40kD Rab9 Effector Protein, p40, RAB9P40) (HRP)
Sign In for Pricing
View Details