Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q7TUF3

Expression Region

1-160

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENVNKF SNPFRRPVAMSVFLFGTFLTIYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Inhibin Beta A (INHbA)
SIPA191Ra01-01 10 µg

Recombinant Inhibin Beta A (INHbA)

Sign In for Pricing
View Details
Recombinant Inhibin Beta A (INHbA)
SIPA191Ra01-02 50 µg

Recombinant Inhibin Beta A (INHbA)

Sign In for Pricing
View Details
Recombinant Inhibin Beta A (INHbA)
SIPA191Ra01-03 200 µg

Recombinant Inhibin Beta A (INHbA)

Sign In for Pricing
View Details
Recombinant Inhibin Beta A (INHbA)
SIPA191Ra01-04 1 mg

Recombinant Inhibin Beta A (INHbA)

Sign In for Pricing
View Details
Recombinant Inhibin Beta A (INHbA)
SIPA191Ra01-05 5 mg

Recombinant Inhibin Beta A (INHbA)

Sign In for Pricing
View Details
Rabbit Polyclonal PPAP2C Antibody
NBP3-11903-100ug 100 µg

Rabbit Polyclonal PPAP2C Antibody

Sign In for Pricing
View Details