Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7U8W7

Expression Region

1-160

Origin

Synechococcus sp. (strain WH8102)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLNFNPLETNLVNLAIVIGVLVWFLRGFLGGILDRRRQAILQELQDAETRLKTATEELS KAQSDLAAAQQKADKIRVDGEARAAAIRSDGEQRTIAAMAAVKQGAAADADAEAARIKDI LRREAALAAIDKVLSDLPSRLDDQAQARLIDSTITNLENA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monocyte Chemotactic Protein-1 (CCL2) (Recombinant)
22060672-1 2 µg

Rat Monocyte Chemotactic Protein-1 (CCL2) (Recombinant)

Sign In for Pricing
View Details
PARP-11 Double Nickase Plasmid (h)
sc-406676-NIC 20 µg

PARP-11 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
NGFR/p75NTR Protein, Human, Recombinant (His)
TMPY-02615-01 5 µg

NGFR/p75NTR Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
NGFR/p75NTR Protein, Human, Recombinant (His)
TMPY-02615-02 10 µg

NGFR/p75NTR Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
NGFR/p75NTR Protein, Human, Recombinant (His)
TMPY-02615-03 20 µg

NGFR/p75NTR Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
NGFR/p75NTR Protein, Human, Recombinant (His)
TMPY-02615-04 50 µg

NGFR/p75NTR Protein, Human, Recombinant (His)

Sign In for Pricing
View Details