Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7U8W7

Expression Region

1-160

Origin

Synechococcus sp. (strain WH8102)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLNFNPLETNLVNLAIVIGVLVWFLRGFLGGILDRRRQAILQELQDAETRLKTATEELS KAQSDLAAAQQKADKIRVDGEARAAAIRSDGEQRTIAAMAAVKQGAAADADAEAARIKDI LRREAALAAIDKVLSDLPSRLDDQAQARLIDSTITNLENA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Hepatitis G Virus Antibody [PerCP]
NB100-93584PCP 0.1 mL

Rabbit Polyclonal Hepatitis G Virus Antibody [PerCP]

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (OTI3D8) [Dylight 594]
NBP2-70407DL594 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (OTI3D8) [Dylight 594]

Sign In for Pricing
View Details
Human MYF5 (Myogenic factor 5) ELISA Kit
orb3130980-01 48 Tests

Human MYF5 (Myogenic factor 5) ELISA Kit

Sign In for Pricing
View Details
Human MYF5 (Myogenic factor 5) ELISA Kit
orb3130980-02 96 Tests

Human MYF5 (Myogenic factor 5) ELISA Kit

Sign In for Pricing
View Details
Calcyon (G-8) Alexa Fluor® 594
sc-271004 AF594 200 µg/mL

Calcyon (G-8) Alexa Fluor® 594

Sign In for Pricing
View Details
Brilliant Violet 421™ anti-human CD62P (P-Selectin)
GT08175 100 Tests

Brilliant Violet 421™ anti-human CD62P (P-Selectin)

Sign In for Pricing
View Details