Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhE2 (mnhE2)
This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhE2 (mnhE2) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Putative antiporter subunit mnhE2, Mrp complex subunit E2, Putative NADH-ubiquinone oxidoreductase subunit mnhE2
UniProt
Q8CQ46
Expression Region
1-160
Origin
Staphylococcus epidermidis (strain ATCC 12228)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKQVVLNIVIAFLWVLFQDEDEFKFTTFFAGFLIGLIVIYILHRFFGEEFYLKKIWVAIK FLAVYLYQLITSSISTINYILFKTNEVNPGLLTYETSLKSNWAITFLTILIIITPGSTVI RISKNTNKFFIHSIDVSEKDKENLLKSIKQYEDLILEVTR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6269648-01 0.1 mL
HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (PE)
Sign In for Pricing
View Details MBS6269648-02 5x 0.1 mL
HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (PE)
Sign In for Pricing
View Details 