Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psilotum nudum Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Psilotum nudum Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q8WHZ2

Expression Region

1-160

Origin

Psilotum nudum (Whisk fern) (Lycopodium nudum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVTKKPDLNDPVSRAKLAKGMGHNYYGEPAWPNDLLYIFPIVILGTIACIAGLAVLEPS MIGEPANPFATPLEILPEWYFYPVFQILRTVPNKLLGVLLMASVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVAIWLGIGAALPIDRSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL
BNC402897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (BA17), CF405S conjugate, 0.1mg/mL
BNC040666-100 1x 100 µL

Cytokeratin 19 (BA17), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF568 conjugate, 0.1mg/mL
BNC681203-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (124), CF405S conjugate, 0.1mg/mL
BNC040530-500 1x 500 µL

Bcl-2 (124), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details