Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q8M9Z5

Expression Region

1-160

Origin

Chaetosphaeridium globosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVCIFGTIACTVGLSVLEPV IVGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAGVPVGLLTVPFIENVNKF QNPFRRPVATTVFLLGTVVAIWLGIGAALPIDTSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAG2 Rabbit Polyclonal Antibody
TA373913 100 µL

BAG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ANGPTL3 Antibody Pair Set
E-KAB-0413 50 µL & 100 µg

Human ANGPTL3 Antibody Pair Set

Sign In for Pricing
View Details
IL2 Antibody
KC-464-01 50 μL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-464-02 100 µL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-464-03 1 mL

IL2 Antibody

Sign In for Pricing
View Details
Rpl29 Mouse Gene Knockout Kit (CRISPR)
KN515034 1 Kit

Rpl29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details