Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhE2, Mrp complex subunit E2, Putative NADH-ubiquinone oxidoreductase subunit mnhE2

UniProt

Q99VY8

Expression Region

1-160

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWAITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APP Antibody, HRP conjugated
A42551-100UG 100 µg

APP Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral mouse Akp3 shRNA (UAS) - Lentiviral mouse Akp3 shRNA (UAS) (100)
GTR15266598 1 Vial

Lentiviral mouse Akp3 shRNA (UAS) - Lentiviral mouse Akp3 shRNA (UAS) (100)

Sign In for Pricing
View Details
ACHM1 Protein Vector (Human) (pPM-N-D-C-HA)
PV319192 500 ng

ACHM1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Human GDF11 (Growth Differentiation Factor 11) ELISA Kit
EKE61103 96 Tests

Human GDF11 (Growth Differentiation Factor 11) ELISA Kit

Sign In for Pricing
View Details
Human PGLYRP4 Pre-designed siRNA Set A
SI012052A 1 Each

Human PGLYRP4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Boc Rat Pre-designed siRNA Set A
HY-RS24135 1 Set

Boc Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details