Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhE2, Mrp complex subunit E2, Putative NADH-ubiquinone oxidoreductase subunit mnhE2

UniProt

Q99VY8

Expression Region

1-160

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWAITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bestrophin 2 Polyclonal Antibody, FITC Conjugated
bs-11041R-FITC 100 µL

Bestrophin 2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
ACOT9 Rabbit Polyclonal Antibody
E53P08099 100 µL

ACOT9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BANF1L1 Protein Vector (Human) (pPB-His-MBP)
PV326234 500 ng

BANF1L1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Perlecan (E-6) Alexa Fluor® 594
sc-377219 AF594 200 µg/mL

Perlecan (E-6) Alexa Fluor® 594

Sign In for Pricing
View Details
CLDN7 Antibody - middle region : Biotin (ARP33613_P050-Biotin)
ARP33613_P050-Biotin 100 µL

CLDN7 Antibody - middle region : Biotin (ARP33613_P050-Biotin)

Sign In for Pricing
View Details
Relebactam
90031021-100mg 100 mg

Relebactam

Sign In for Pricing
View Details