Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein cornichon homolog 2 (Cnih2)

This Recombinant Mouse Protein cornichon homolog 2 (Cnih2) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Protein cornichon homolog 2, Cornichon-like protein

UniProt

O35089

Expression Region

1-160

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL
BNC742171-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD48 protein (His tag)
PDMH100144-01 20 µg

Recombinant Human CD48 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD48 protein (His tag)
PDMH100144-02 100 µg

Recombinant Human CD48 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD48 protein (His tag)
PDMH100144-03 500 µg

Recombinant Human CD48 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD48 protein (His tag)
PDMH100144-04 1 mg

Recombinant Human CD48 protein (His tag)

Sign In for Pricing
View Details
Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), 0.2mg/mL
BNUB2181-500 1x 500 µL

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), 0.2mg/mL

Sign In for Pricing
View Details