Recombinant Nostoc sp. Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Nostoc sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
P12117
Expression Region
1-160
Origin
Nostoc sp. (strain PCC 7906)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MATQKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFAAIVALAVLDPA MTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKF QNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400040-100 1x 100 µL
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681958-500 1x 500 µL
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942554-100 1x 100 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details