Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

P19586

Expression Region

1-160

Origin

Scenedesmus obliquus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVTKKPDLTDPVLKEKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTFACVIGLSVLDPA AIGEPANPFATPLEILPEWYFYPVFQLLRTVPNKLLGVLLMAAVPAGLITVPFIENINKF QNPYRRPIATTLFLVGTLVAVWLGIGATLPIEISLTFGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPARC Rabbit Polyclonal Antibody
AP02133SU-N 100 µL

SPARC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human HtrA2/Omi Protein (His Tag)
PKSH033408-01 10 µg

Recombinant Human HtrA2/Omi Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HtrA2/Omi Protein (His Tag)
PKSH033408-02 50 µg

Recombinant Human HtrA2/Omi Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS714882 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
UBC3B (UBE2R2) Rabbit Polyclonal Antibody
TA383026 100 µL

UBC3B (UBE2R2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFAND3 Rabbit Polyclonal Antibody
TA365172 100 µL

ZFAND3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details