What is the catalog number for Recombinant Cytochrome b6-f complex subunit 4 (petD)?

The catalog number for Recombinant Cytochrome b6-f complex subunit 4 (petD) is orb2931063.

What sizes are available for Recombinant Cytochrome b6-f complex subunit 4 (petD)?

Recombinant Cytochrome b6-f complex subunit 4 (petD) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Cytochrome b6-f complex subunit 4 (petD) come in?

Recombinant Cytochrome b6-f complex subunit 4 (petD) is available in 2 different pack sizes.

Is Recombinant Cytochrome b6-f complex subunit 4 (petD) in stock?

Recombinant Cytochrome b6-f complex subunit 4 (petD) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

P19586

Expression Region

1-160

Origin

Scenedesmus obliquus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVTKKPDLTDPVLKEKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTFACVIGLSVLDPA AIGEPANPFATPLEILPEWYFYPVFQLLRTVPNKLLGVLLMAAVPAGLITVPFIENINKF QNPYRRPIATTLFLVGTLVAVWLGIGATLPIEISLTFGLF