Recombinant Chlamydophila psittaci Sulfur-rich protein (srp)
This Recombinant Chlamydophila psittaci Sulfur-rich protein (srp) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Sulfur-rich protein
UniProt
P28164
Expression Region
1-160
Origin
Chlamydophila psittaci (strain ATCC VR-125 / 6BC) (Chlamydia psittaci)
Field of Research
Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSGENANSIGSDVTSLIQPGLEQVMQDEGVQVSLINSVLGWCRVHIINPIKTSKIVQSRA FQITMVVLGIILLIAGLALTFVLQGQLGKNAFLFLIPAVIGLVKLLATSVCMEKPCTPEK WRLCKRLLATTEDILDDGQINQSNTIFTMNSSESTSASAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC610470-500 1x 500 µL
CD45 / LCA (2B11), CF660R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041266-500 1x 500 µL
Cytokeratin 8 (KRT8) (B22.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882422-500 1x 500 µL
BOB.1 (B-Cell Marker) (BOB1/2422), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details