Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodium/proline symporter (putP)

This Recombinant Sodium/proline symporter (putP) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Sodium/proline symporter, Proline permease

UniProt

P23723

Expression Region

1-160

Origin

Klebsiella oxytoca

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAISTPMLVTFIVYIFGMVLIGFIAWRSTKNFDDYILGGRSLGPFVTALSAGASDMSGWL LMGLPGAIFISGISESWIAIGLTLGAWINWKLVAGRLRVHTEVNNNALTXPDYFTGRFED HHNFHGFRTRVVKHIACILYRHDGALCGIGSRHAQRHFLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX7
CSB-CL017493HU 10 μg Plasmid + 200 μL Glycerol

PAX7

Sign In for Pricing
View Details
CDCA7L Polyclonal Antibody, Biotin Conjugated
A70142-050 50 μL

CDCA7L Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Prdm14 (NM_001081209) Mouse Tagged ORF Clone
MG215165 10 µg

Prdm14 (NM_001081209) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Glud1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3271308 1.0 µg DNA

Glud1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
BRAF (v-raf murine Sarcoma Viral Oncogene Homolog B1, B-RAF1, BRAF1, FLJ95109, MGC126806, MGC138284, RAFB1) (AP) discontinued
243870-AP 100 µL

BRAF (v-raf murine Sarcoma Viral Oncogene Homolog B1, B-RAF1, BRAF1, FLJ95109, MGC126806, MGC138284, RAFB1) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Lymphotactin ELISA Kit
MBS732696-01 48 Well

Rabbit Lymphotactin ELISA Kit

Sign In for Pricing
View Details