Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2160 (AF_2160)
This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2160 (AF_2160) spans the amino acid sequence from region 1-161.
Product Specifications
Product Name Alternative
Uncharacterized protein AF_2160
UniProt
O28122
Expression Region
1-161
Origin
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVKSCSVGWGAKVAAVFAALYTSILGLAVLIPHANSAIEVFSAVMAAGLGILIALLAVPF ISEITDKTETLEVEVIGEVVVEDSLSFGGANAGLKSERIFVADKGLVIDGYLFEWQKIKF EIEKDEIILRLPSGRRLPIPYSEELAEMLRKSKTSYFIDTK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400043-100 1x 100 µL
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681387-100 1x 100 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details