Recombinant Rhodospirillum rubrum ATP synthase subunit b' (atpG)
This Recombinant Rhodospirillum rubrum ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-161.
Product Specifications
Product Name Alternative
ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
UniProt
Q2RPA6
Expression Region
1-161
Origin
Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPQFDPSSFPSQIVWLVIALVAMYFVMSRLAIPRLAEVLEQRQRLINDDLKQAEALKAET EAAIAAYETALAEARARAHDEIRAVTEAAAKAAEARNAEVAKALNTRIKDGEARIVQARD EALTHVREVAGAVASDIVGKLAGLRVDDAALTAAVAAAIKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040746-100 1x 100 µL
CD5 (CD5/54/F6), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881931-100 1x 100 µL
CD3e (T-Cell Marker) (C3e/1931), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741970-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details