Recombinant Rhizobium meliloti Probable K (+) /H (+) antiporter subunit E (phaE)
This Recombinant Rhizobium meliloti Probable K (+) /H (+) antiporter subunit E (phaE) spans the amino acid sequence from region 1-161.
Product Specifications
Product Name Alternative
Probable K (+) /H (+) antiporter subunit E, pH adaptation potassium efflux system protein E, Pha system subunit E
UniProt
Q52982
Expression Region
1-161
Origin
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRTWFPYPLLSIALLLMWLLLSQSVTPGSIVLGLVVSTVLAWVTLNLQPARSRLHRWSRI AGFILRVVGDVIRSNIAVTLIILRAGRRPVNAGFMTVSLDLDDENALALLACVVTATPGT AWLEYDRRQKILLFHVLDIENEDLWRKTITRYAADLKEIFE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042110-100 1x 100 µL
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880818-500 1x 500 µL
CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details