Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU01_0910 (ECU01_0910)

This Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU01_0910 (ECU01_0910) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ECU01_0910

UniProt

Q8SWK6

Expression Region

1-161

Origin

Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSPGRRSGSAMSLRKLGLVVAIFFFMMGTTVVVLYKYLNAKSSGGTEQKPEGAFGIPLR KESSRLRPNGGERMSILSMDAEHVRRLFDVLFEDINNAKEAYEDIMNLLEEYKVKRGISK KTKSFIDMLLSFLKSAPGTESEDIKILKSLANIVAKHYLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-500 1x 500 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/983), CF405S conjugate, 0.1mg/mL
BNC040983-100 1x 100 µL

CD117 (KIT/983), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details