Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Promethin (TMEM159)

This Recombinant Human Promethin (TMEM159) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Promethin, Transmembrane protein 159

UniProt

Q96B96

Expression Region

1-161

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIV MSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIAS YVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSAEFEGLYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbohydrate sulfotransferase 4 (CHST4) Rabbit Polyclonal Antibody
TA368284 100 µL

Carbohydrate sulfotransferase 4 (CHST4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA4 Antibody
KC-3833-01 50 μL

SERPINA4 Antibody

Sign In for Pricing
View Details
SERPINA4 Antibody
KC-3833-02 100 µL

SERPINA4 Antibody

Sign In for Pricing
View Details
SERPINA4 Antibody
KC-3833-03 1 mL

SERPINA4 Antibody

Sign In for Pricing
View Details
Hypromellose Acetate Succinate
TRC-H998793-5G 5 g

Hypromellose Acetate Succinate

Sign In for Pricing
View Details
CF®680 Maleimide
#92029 1x 1 µmol

CF®680 Maleimide

Sign In for Pricing
View Details