Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vitamin K epoxide reductase complex subunit 1 (Vkorc1)

This Recombinant Mouse Vitamin K epoxide reductase complex subunit 1 (Vkorc1) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Vitamin K epoxide reductase complex subunit 1, EC= 1.1.4.1, Vitamin K1 2,3-epoxide reductase subunit 1

UniProt

Q9CRC0

Expression Region

1-161

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWG RGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYL AWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 Antibody (Middle Region)
R32814 100 µg

Bcl-2 Antibody (Middle Region)

Sign In for Pricing
View Details
CLEC18C Human qPCR Primer Pair (NM_173619)
HP218415 200 Reactions

CLEC18C Human qPCR Primer Pair (NM_173619)

Sign In for Pricing
View Details
Rps15 Mouse Gene Knockout Kit (CRISPR)
KN515082 1 Kit

Rps15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ITGAE Polyclonal Antibody
E-AB-11334-01 20 µL

ITGAE Polyclonal Antibody

Sign In for Pricing
View Details
ITGAE Polyclonal Antibody
E-AB-11334-02 60 µL

ITGAE Polyclonal Antibody

Sign In for Pricing
View Details
ITGAE Polyclonal Antibody
E-AB-11334-03 120 µL

ITGAE Polyclonal Antibody

Sign In for Pricing
View Details