Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vitamin K epoxide reductase complex subunit 1 (Vkorc1)

This Recombinant Mouse Vitamin K epoxide reductase complex subunit 1 (Vkorc1) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Vitamin K epoxide reductase complex subunit 1, EC= 1.1.4.1, Vitamin K1 2,3-epoxide reductase subunit 1

UniProt

Q9CRC0

Expression Region

1-161

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWG RGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYL AWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Abrine
TRC-A109070-250MG 250 mg

L-Abrine

Sign In for Pricing
View Details
PAX6 (PAX6/1166), CF594 conjugate, 0.1mg/mL
BNC941166-500 1x 500 µL

PAX6 (PAX6/1166), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RDH5 (NM_002905) Human Over-expression Lysate
LC401019 20 µg

RDH5 (NM_002905) Human Over-expression Lysate

Sign In for Pricing
View Details
MYO6 Antibody
KC-1861-01 50 μL

MYO6 Antibody

Sign In for Pricing
View Details
MYO6 Antibody
KC-1861-02 100 µL

MYO6 Antibody

Sign In for Pricing
View Details
MYO6 Antibody
KC-1861-03 1 mL

MYO6 Antibody

Sign In for Pricing
View Details