Recombinant Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-161.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q9TLZ8
Expression Region
1-161
Origin
Cyanidium caldarium
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTIIKKPDLNNALLRAKLAKGMGHSYYGEPAWPNDLLYTFPIVILGTITCCVGLAVLEPS SLGEPANPFATPLEILPEWYLYPTFNMLRIIPNKLFGVISISLVPVGLGIVPFVENINKF QNPFRRPIATSVFIFGTVTTVWLGIGATMSIDKALTLGIFF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1027305 3x 1.0 µg
IGHD1-7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
K1878307 1.0 µg DNA
RPL5P35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details MBS6292506-01 0.1 mL
DMRTA2, CT (DMRTA2, DMRT5, Doublesex-and mab-3-related transcription factor A2, Doublesex-and mab-3-related transcription factor 5) (MaxLight 650)
Sign In for Pricing
View Details