Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Type-1 angiotensin II receptor-associated protein (Agtrap)

This Recombinant Mouse Type-1 angiotensin II receptor-associated protein (Agtrap) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Type-1 angiotensin II receptor-associated protein, AT1 receptor-associated protein

UniProt

Q9WVK0

Expression Region

1-161

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLGG LVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLR PDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAAPRGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Msh2 Mouse Gene Knockout Kit (CRISPR)
KN310420RB 1 Kit

Msh2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GCC1 (NM_024523) Human Recombinant Protein
TP304339M 100 µg

GCC1 (NM_024523) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS708652 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (57), 1mg/mL
BNUM0139-50 1x 50 µL

ACTH (Adrenocorticotrophic Hormone) (57), 1mg/mL

Sign In for Pricing
View Details
SPRR2B (NM_001017418) Human Over-expression Lysate
LY422787 100 µg

SPRR2B (NM_001017418) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Bromo-8-chloro-1,5-naphthyridine
TRC-B594170-1G 1 g

3-Bromo-8-chloro-1,5-naphthyridine

Sign In for Pricing
View Details