Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Type-1 angiotensin II receptor-associated protein (Agtrap)

This Recombinant Mouse Type-1 angiotensin II receptor-associated protein (Agtrap) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Type-1 angiotensin II receptor-associated protein, AT1 receptor-associated protein

UniProt

Q9WVK0

Expression Region

1-161

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLGG LVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLR PDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAAPRGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI2 Recombinant Rabbit monoclonal Antibody
HA723751 100 µL

TFPI2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
FANCF Polyclonal Antibody
E-AB-15015-01 20 µL

FANCF Polyclonal Antibody

Sign In for Pricing
View Details
FANCF Polyclonal Antibody
E-AB-15015-02 60 µL

FANCF Polyclonal Antibody

Sign In for Pricing
View Details
FANCF Polyclonal Antibody
E-AB-15015-03 120 µL

FANCF Polyclonal Antibody

Sign In for Pricing
View Details
FANCF Polyclonal Antibody
E-AB-15015-04 200 µL

FANCF Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638997 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details