Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphotransferase enzyme IIB component glvB (glvB)

This Recombinant Phosphotransferase enzyme IIB component glvB (glvB) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Phosphotransferase enzyme IIB component glvB, EC= 2.7.1.69, PTS system EIIB component

UniProt

P69790

Expression Region

1-161

Origin

Shigella flexneri

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQ TTAAEPKKELDQAAGILQALGGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGV FRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD1 Rabbit Polyclonal Antibody (Biotin)
orb2127262 100 µL

TEAD1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Arf3 (NM_007478) Mouse Tagged ORF Clone
MG201629 10 µg

Arf3 (NM_007478) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GOLM1 siRNA (Human)
MBS8208492-01 15 nmol

GOLM1 siRNA (Human)

Sign In for Pricing
View Details
GOLM1 siRNA (Human)
MBS8208492-02 30 nmol

GOLM1 siRNA (Human)

Sign In for Pricing
View Details
GOLM1 siRNA (Human)
MBS8208492-03 5x 30 nmol

GOLM1 siRNA (Human)

Sign In for Pricing
View Details
Mouse Tgfbi Pre-designed siRNA Set A
SI114529A 1 Each

Mouse Tgfbi Pre-designed siRNA Set A

Sign In for Pricing
View Details