Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Phosphotransferase enzyme IIB component glvB (glvB)

This Recombinant Escherichia coli Phosphotransferase enzyme IIB component glvB (glvB) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Phosphotransferase enzyme IIB component glvB, EC= 2.7.1.69, PTS system EIIB component

UniProt

P69789

Expression Region

1-161

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQ TTAAEPKKELDQAAGILQALGGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGV FRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5, 5'- [1, 4-Phenylenebis (oxy) ] bis-1, 3-isobenzofurandione
FI153486-01 10 g

5, 5'- [1, 4-Phenylenebis (oxy) ] bis-1, 3-isobenzofurandione

Sign In for Pricing
View Details
5, 5'- [1, 4-Phenylenebis (oxy) ] bis-1, 3-isobenzofurandione
FI153486-02 25 g

5, 5'- [1, 4-Phenylenebis (oxy) ] bis-1, 3-isobenzofurandione

Sign In for Pricing
View Details
Human Glycoprotein endo-alpha-1,2-mannosidase (MANEA) ELISA Kit
RK06326 96 Tests

Human Glycoprotein endo-alpha-1,2-mannosidase (MANEA) ELISA Kit

Sign In for Pricing
View Details
Methyl cinnamate (Standard)
HY-W017212R-01 50 mg

Methyl cinnamate (Standard)

Sign In for Pricing
View Details
Methyl cinnamate (Standard)
HY-W017212R-02 100 mg

Methyl cinnamate (Standard)

Sign In for Pricing
View Details
Methyl cinnamate (Standard)
HY-W017212R-03 250 mg

Methyl cinnamate (Standard)

Sign In for Pricing
View Details