Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ybjO (ybjO)

This Recombinant Inner membrane protein ybjO (ybjO) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Inner membrane protein ybjO

UniProt

P0AAZ2

Expression Region

1-162

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WSB2 Rabbit Polyclonal Antibody
53484-01 50 µL

WSB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WSB2 Rabbit Polyclonal Antibody
53484-02 100 µL

WSB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
β-Gentiobiose
sc-280730B 100 mg

β-Gentiobiose

Sign In for Pricing
View Details
Human RFPL4AL1 knockdown cell line
ABC-KD12864 1 Vial

Human RFPL4AL1 knockdown cell line

Sign In for Pricing
View Details
DEDD2 (NM_133328) Human Tagged Lenti ORF Clone
RC206798L4 10 µg

DEDD2 (NM_133328) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
[2- (3-Aminophenyl) ethyl]carbamic acid tert-butyl ester
260973-01 50 mg

[2- (3-Aminophenyl) ethyl]carbamic acid tert-butyl ester

Sign In for Pricing
View Details