Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ybjO (ybjO)

This Recombinant Inner membrane protein ybjO (ybjO) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Inner membrane protein ybjO

UniProt

P0AAZ1

Expression Region

1-162

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Abcb1b activation kit by CRISPRa
GA203199 1 Kit

Mouse Abcb1b activation kit by CRISPRa

Sign In for Pricing
View Details
ECI2 Antibody
KC-563-01 50 μL

ECI2 Antibody

Sign In for Pricing
View Details
ECI2 Antibody
KC-563-02 100 µL

ECI2 Antibody

Sign In for Pricing
View Details
ECI2 Antibody
KC-563-03 1 mL

ECI2 Antibody

Sign In for Pricing
View Details
Cig2 (3A11/5), CF647 conjugate, 0.1mg/mL
BNC472827-100 1x 100 µL

Cig2 (3A11/5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SNX30 Human Gene Knockout Kit (CRISPR)
KN424829 1 Kit

SNX30 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details