Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ybjO (ybjO)

This Recombinant Inner membrane protein ybjO (ybjO) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Inner membrane protein ybjO

UniProt

P0AAZ1

Expression Region

1-162

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX4 (NM_001136034) Human Over-expression Lysate
LC427781 20 µg

DDX4 (NM_001136034) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS706280 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
MICALL1 (C-term) Rabbit Polyclonal Antibody
AP52694PU-N 400 µL

MICALL1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(4-Chlorobenzyl)pyridine
TRC-C382073-500MG 500 mg

2-(4-Chlorobenzyl)pyridine

Sign In for Pricing
View Details
Recombinant SRSF3 Antibody
RC-6015-01 50 μL

Recombinant SRSF3 Antibody

Sign In for Pricing
View Details
Recombinant SRSF3 Antibody
RC-6015-02 100 µL

Recombinant SRSF3 Antibody

Sign In for Pricing
View Details