Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ybjO (ybjO)

This Recombinant Inner membrane protein ybjO (ybjO) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Inner membrane protein ybjO

UniProt

P0AAZ3

Expression Region

1-162

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis Wash Seal Agilent 1050 1100
CHR5407 1 Each

Kinesis Wash Seal Agilent 1050 1100

Sign In for Pricing
View Details
Nmt2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3385307 1.0 µg DNA

Nmt2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PsbD Antibody
PHY5408S 150 μg

PsbD Antibody

Sign In for Pricing
View Details
3-Bromo-4-iodophenacyl bromide
OR400431 1 Each

3-Bromo-4-iodophenacyl bromide

Sign In for Pricing
View Details
M/M005/NT-PP-PHOLUMB-Dia 150/1-B Electrical & Equipment Safety Signs (No Adhesive)
835626 1 Pack (1 Panel (s) x 1 Pack)

M/M005/NT-PP-PHOLUMB-Dia 150/1-B Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
Recombinant Rabbit Anti-Human TP63 Monoclonal Antibody, clone CQ7149
CABT-Z211R 100 µl

Recombinant Rabbit Anti-Human TP63 Monoclonal Antibody, clone CQ7149

Sign In for Pricing
View Details