Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ybjO (ybjO)

This Recombinant Inner membrane protein ybjO (ybjO) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Inner membrane protein ybjO

UniProt

P0AAZ3

Expression Region

1-162

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC3A/B Rabbit Polyclonal Antibody (HRP)
orb474555 100 µL

LC3A/B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
3110009E18Rik Protein Lysate (Mouse) with C-HA Tag
10530035 100 µg

3110009E18Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral human DYNLRB2 shRNA (UAS) - Lentiviral human DYNLRB2 shRNA (UAS, iRFP) (25)
GTR15131342 1 Vial

Lentiviral human DYNLRB2 shRNA (UAS) - Lentiviral human DYNLRB2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband® (HRP Conjugate)
A00498-1-HRP 100 µg/Vial

Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
EXOSC5 Antibody, Biotin conjugated
CSB-PA878857LD01HU-01 50 µg

EXOSC5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
EXOSC5 Antibody, Biotin conjugated
CSB-PA878857LD01HU-02 100 µg

EXOSC5 Antibody, Biotin conjugated

Sign In for Pricing
View Details