Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

This Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 31, mitochondrial

UniProt

A7TFU8

Expression Region

1-162

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRIPSSFDYKDNVKDVSEMDFMEKLVFRAKQQPLVPIGCLLTTGAIVLAAQSVRSGNKN KAQVFFRWRVGLQAATLVALLAGSYIYSSNKAERKTEEQLLKEKAKMREQLWIQELERRE QETEARRKKAEMFRLKAKENEEASKNLEQELKALESKVNASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTPA Polyclonal Antibody
E-AB-90859-01 60 µL

TTPA Polyclonal Antibody

Sign In for Pricing
View Details
TTPA Polyclonal Antibody
E-AB-90859-02 120 µL

TTPA Polyclonal Antibody

Sign In for Pricing
View Details
TTPA Polyclonal Antibody
E-AB-90859-03 200 µL

TTPA Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant PPAR gamma Antibody
RC-6832-01 50 μL

Recombinant PPAR gamma Antibody

Sign In for Pricing
View Details
Recombinant PPAR gamma Antibody
RC-6832-02 100 µL

Recombinant PPAR gamma Antibody

Sign In for Pricing
View Details
Recombinant PPAR gamma Antibody
RC-6832-03 1 mL

Recombinant PPAR gamma Antibody

Sign In for Pricing
View Details