Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mitochondrial fission process protein 1 (mtp-18)

This Recombinant Mitochondrial fission process protein 1 (mtp-18) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Mitochondrial fission process protein 1, Mitochondrial 18 kDa protein, MTP18

UniProt

B6IJ52

Expression Region

1-162

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPVESSNVEKDIFRDTPVRFLGKRYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSVD KGFKESKKPHANDTEKAKRVAIIAVDTVLWQTFASVLIPGFTINRFCFFTNMLLEKSTKL PTNLRKWTVTALGLATIPFIVHPIDAFVEDAMNKTARKVYNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-1910-3p inhibitor
HY-RI00364-01 5 nmol

Hsa-miR-1910-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-1910-3p inhibitor
HY-RI00364-02 20 nmol

Hsa-miR-1910-3p inhibitor

Sign In for Pricing
View Details
Rabbit Anti-Collagen I/COL1A2 Polyclonal Antibody
PAV6219 100 μL

Rabbit Anti-Collagen I/COL1A2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal DIMT1L Antibody
NBP2-97740-50ul 50 µL

Rabbit Polyclonal DIMT1L Antibody

Sign In for Pricing
View Details
PDF (NM_022341) Human Tagged Lenti ORF Clone
RC205788L1 10 µg

PDF (NM_022341) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse PIK3C3 shRNA Plasmid
abx981398-01 150 µg

Mouse PIK3C3 shRNA Plasmid

Sign In for Pricing
View Details