Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mitochondrial fission process protein 1 (mtp-18)

This Recombinant Mitochondrial fission process protein 1 (mtp-18) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Mitochondrial fission process protein 1, Mitochondrial 18 kDa protein, MTP18

UniProt

B6IJ52

Expression Region

1-162

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPVESSNVEKDIFRDTPVRFLGKRYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSVD KGFKESKKPHANDTEKAKRVAIIAVDTVLWQTFASVLIPGFTINRFCFFTNMLLEKSTKL PTNLRKWTVTALGLATIPFIVHPIDAFVEDAMNKTARKVYNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL16 rabbit polyclonal antibody, Biotin
PP1036B1 25 µg

IL16 rabbit polyclonal antibody, Biotin

Sign In for Pricing
View Details
Llama genomic DNA
GL-260 0.1 mg

Llama genomic DNA

Sign In for Pricing
View Details
PURA (PUR1, Transcriptional Activator Protein Pur-alpha, Purine-rich Single-stranded DNA-binding Protein alpha) (PE)
132099-PE 100 µL

PURA (PUR1, Transcriptional Activator Protein Pur-alpha, Purine-rich Single-stranded DNA-binding Protein alpha) (PE)

Sign In for Pricing
View Details
TJAP1 (Tight Junction Associated Protein 1 (peripheral), DKFZp686F06131, PILT, TJP4)
252685 100 µg

TJAP1 (Tight Junction Associated Protein 1 (peripheral), DKFZp686F06131, PILT, TJP4)

Sign In for Pricing
View Details
Mouse Activated Protein C (APC) ELISA kit
GA-E0804MS-01 48 Tests

Mouse Activated Protein C (APC) ELISA kit

Sign In for Pricing
View Details
Mouse Activated Protein C (APC) ELISA kit
GA-E0804MS-02 96 Tests

Mouse Activated Protein C (APC) ELISA kit

Sign In for Pricing
View Details