Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mitochondrial fission process protein 1 (mtp-18)

This Recombinant Mitochondrial fission process protein 1 (mtp-18) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Mitochondrial fission process protein 1, Mitochondrial 18 kDa protein, MTP18

UniProt

B6IJ52

Expression Region

1-162

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPVESSNVEKDIFRDTPVRFLGKRYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSVD KGFKESKKPHANDTEKAKRVAIIAVDTVLWQTFASVLIPGFTINRFCFFTNMLLEKSTKL PTNLRKWTVTALGLATIPFIVHPIDAFVEDAMNKTARKVYNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM6 Antibody
OAGA07433-100UL 100 µL

MCM6 Antibody

Sign In for Pricing
View Details
Ssp-10 Antibody
orb802536 2 mg

Ssp-10 Antibody

Sign In for Pricing
View Details
DNAJC24 Protein Vector (Human) (pPM-C-HA)
PV012795 500 ng

DNAJC24 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Hyaluronidase-2 (HYAL2) Mouse ELISA Kit
E1482 96 Tests

Hyaluronidase-2 (HYAL2) Mouse ELISA Kit

Sign In for Pricing
View Details
Cdc42 Expression Vector Set
STA-455 1 Kit

Cdc42 Expression Vector Set

Sign In for Pricing
View Details
ACADM Antibody; Biotin conjugated
MBS7006205-01 0.05 mg

ACADM Antibody; Biotin conjugated

Sign In for Pricing
View Details