Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0480 (TP_0480)

This Recombinant Treponema pallidum Uncharacterized protein TP_0480 (TP_0480) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0480

UniProt

O83493

Expression Region

1-162

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRALFSLFRSLHANTHPADLAHAAALALALALLPRSSLLWYLLFAVCFFIRLNRGLLLL SLVLFGFVVPSFDPWLDSLGNWALCLPRLQPVYRALIEIPFVGLARFYNTMIAGGLVAGA LCYLPCYALARCAVTAYRTYLYPKIHHATIFFLVRNAPLCKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI16 Human Gene Knockout Kit (CRISPR)
KN402193 1 Kit

IFI16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,3-Dihydroxy-1-naphthaldehyde
TRC-D319090-1G 1 g

2,3-Dihydroxy-1-naphthaldehyde

Sign In for Pricing
View Details
Trimecaine Hydrochloride
TRC-T795620-1G 1 g

Trimecaine Hydrochloride

Sign In for Pricing
View Details
rac Matairesinol-d6
TRC-M197853-1MG 1 mg

rac Matairesinol-d6

Sign In for Pricing
View Details
CDC5L Polyclonal Antibody
E-AB-14714-01 20 µL

CDC5L Polyclonal Antibody

Sign In for Pricing
View Details
CDC5L Polyclonal Antibody
E-AB-14714-02 60 µL

CDC5L Polyclonal Antibody

Sign In for Pricing
View Details