Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella denitrificans UPF0114 protein Sden_0436 (Sden_0436)

This Recombinant Shewanella denitrificans UPF0114 protein Sden_0436 (Sden_0436) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

UPF0114 protein Sden_0436

UniProt

Q12S48

Expression Region

1-162

Origin

Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKVFEKLMYASRWIMAPIYLGLSLILFALGIKFFQEIFHLIPNIFEIAEVDLVLITLSL IDITLVGGLLIMVMFSGYENFVSQLDVGESSEKLNWLGKMDAGSLKNKVAASIVAISSIH LLKVFMNAENIANDKIMWYLLIHITFVLSAFAMGYLDKITRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-100 1x 100 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details