Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b', chloroplastic (atpG)

This Recombinant ATP synthase subunit b', chloroplastic (atpG) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

ATP synthase subunit b', chloroplastic, ATP synthase F (0) sector subunit b', ATPase subunit II

UniProt

Q4G3A0

Expression Region

1-162

Origin

Emiliania huxleyi

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLIMLVTNAVTLSEAAGGLFDFNATLPLQALQFILLTVLLTFIFYKPIGKLLEERETF ISNNLAEASAKLLKADELCEQYETQLKEAKTGAQDVIAKAESEAKGIVAQEITQARADAA SLIAQTNKELEAQKKLALQQLETQIDELSQLIKEKLLGKVVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amyloid-like protein 1 APLP1 Rabbit Polyclonal Antibody (APC)
orb2575371 100 µg

Amyloid-like protein 1 APLP1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CD80 (B7-1)
216332 50 µg

CD80 (B7-1)

Sign In for Pricing
View Details
Malaria Pf. MSP1
32-13551-0.5 0.5 mg

Malaria Pf. MSP1

Sign In for Pricing
View Details
C2orf30 Protein Vector (Human) (pPM-C-HA)
14400022 500 ng

C2orf30 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ZNF207 (Zinc Finger Protein 207, DKFZp761N202) (MaxLight 405) discontinued
253680-ML405 100 µL

ZNF207 (Zinc Finger Protein 207, DKFZp761N202) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Phospho-GATA1 (Ser310) Antibody
E18-3185-2 100 µg -100 µL

Phospho-GATA1 (Ser310) Antibody

Sign In for Pricing
View Details