Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b', chloroplastic (atpG)

This Recombinant ATP synthase subunit b', chloroplastic (atpG) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

ATP synthase subunit b', chloroplastic, ATP synthase F (0) sector subunit b', ATPase subunit II

UniProt

Q4G3A0

Expression Region

1-162

Origin

Emiliania huxleyi

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLIMLVTNAVTLSEAAGGLFDFNATLPLQALQFILLTVLLTFIFYKPIGKLLEERETF ISNNLAEASAKLLKADELCEQYETQLKEAKTGAQDVIAKAESEAKGIVAQEITQARADAA SLIAQTNKELEAQKKLALQQLETQIDELSQLIKEKLLGKVVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT-ATP8 Protein Vector (Human) (pPB-N-His)
PV101779 500 ng

MT-ATP8 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human OBSL1 sgRNA gene knockout kit - Lentiviral human OBSL1 sgRNA gene knockout kit (100)
GTR15392923 1 Vial

Lentiviral human OBSL1 sgRNA gene knockout kit - Lentiviral human OBSL1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
MRPS15 Recombinant Antibody, Cy5 Conjugated
bsm-62540R-Cy5-01 20 µL

MRPS15 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
MRPS15 Recombinant Antibody, Cy5 Conjugated
bsm-62540R-Cy5-02 100 µL

MRPS15 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Vernakalant (RSD1235) 100mg
A11603-100 100 mg

Vernakalant (RSD1235) 100mg

Sign In for Pricing
View Details
ELISA Kit FOR Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
E16374h 96 Tests

ELISA Kit FOR Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1

Sign In for Pricing
View Details