Recombinant Phalaenopsis aphrodite subsp. formosana Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Phalaenopsis aphrodite subsp. formosana Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-163.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q3BAK6
Expression Region
1-163
Origin
Phalaenopsis aphrodite subsp. formosana (Moth orchid)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPLGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGLFQID
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470204-500 1x 500 µL
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681149-500 1x 500 µL
CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 