Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13)

This Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13) spans the amino acid sequence from region 1-163.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, Complex I-B16.6, CI-B16.6, NADH-ubiquinone oxidoreductase B16.6 subunit

UniProt

Q4R6H1

Expression Region

1-163

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVAVCHFRLGPEVWNTASMEMPKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIG TLVYGHWSIMKWNRERRRLQIEDFEARIALMPLFQAETDRRTLQMLRENLEEEAIIMKDV PDWKVGESVFHTTRWVPPLIGELYGLRTTEETIHANYGFMWYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HIDE1 shRNA Plasmid
abx966733-01 150 µg

Human HIDE1 shRNA Plasmid

Sign In for Pricing
View Details
Human HIDE1 shRNA Plasmid
abx966733-02 300 µg

Human HIDE1 shRNA Plasmid

Sign In for Pricing
View Details
Human BAMBI/NMA (NP_036474) VersaClone cDNA
RDC1091 10 µg

Human BAMBI/NMA (NP_036474) VersaClone cDNA

Sign In for Pricing
View Details
Human MFSD12 Knockout HEK293T cell line
GTR15413424 1 Vial

Human MFSD12 Knockout HEK293T cell line

Sign In for Pricing
View Details
Anti-Zebrafish LAMB1A Antibody Picoband® Fluoro550 Conjugated
AZQ8JHV7-Fluoro550 100 µg/Vial

Anti-Zebrafish LAMB1A Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal RTEL1 Antibody
NBP2-22360SS 0.025 mL

Rabbit Polyclonal RTEL1 Antibody

Sign In for Pricing
View Details